PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT26451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 381aa    MW: 41764.5 Da    PI: 7.9207
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT26451genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-142973147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rW ++E+e+++da  ++G + W++I +++  ++t+ q++s+ qky
         EMT26451 29 RERWCPDEHERFLDALLRFGRD-WRKIEEHVR-TKTAVQIRSHAQKY 73
                     78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-152379IPR009057Homeodomain-like
PROSITE profilePS5129416.6832478IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-72780IPR009057Homeodomain-like
SMARTSM007171.3E-82876IPR001005SANT/Myb domain
TIGRFAMsTIGR015577.9E-162876IPR006447Myb domain, plants
PfamPF002499.7E-122973IPR001005SANT/Myb domain
CDDcd001672.83E-73174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MAERGGSGEG TSSSPGKKAR KPYTITRPRE RWCPDEHERF LDALLRFGRD WRKIEEHVRT  60
KTAVQIRSHA QKYFLKVQRL GLAAGLPPPQ HPSRRLAMSQ QQISPADGTA VLHGQPQHCP  120
TDMQNSDWAG SSGTSAWVSH GGAGSQTEPA AATHPGGSSF MGAPSFDDTS MDWTGSGSTG  180
EASAIADAED ETIPLPLSPD DMHFARVYRF IGDIFDPATP CRIEAHLQKL KDMDGITVKT  240
ILLVLRNLET NLTAPQFEPI LGRNIFLLIV GNLRISLYNF ALAFGKAPCL DLLCLEPSEL  300
DVLPCWQGKT PAHSGRSEAD WTWLLNGVYF SGRGLFAGPN KLGKFHLGPN NARGLMMSLL  360
VDPDKIAIFP HLRKQLIKDT P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703065e-70HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227459.11e-113PREDICTED: protein REVEILLE 5-like
TrEMBLM8CRY20.0M8CRY2_AEGTA; Myb-like protein G
STRINGBGIOSGA002364-PA1e-112(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02840.31e-44LHY/CCA1-like 1